HPA020422

PKD1L1 antibody from Sigma-Aldrich
PRO19563
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020422
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020422, RRID:AB_1855434
Product name
Anti-PKD1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020422
Antibody type
Polyclonal
Antigen
Polycystic kidney disease protein 1-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDDQERCLQAACCLSFGGELSVSTDKSWGLHLCSC
SPPGGGLWVEVYANHVLLMSDGKCGCPWCALNGKA
EDRESQSPSSSASRQKNIWKTTSEAALSVVNEKTQ
AVVNEKTQAPLDCDNSAD
Storage
-20C
Provider Type Product Number
- No reagents -