HPA024634

SAMD12 antibody from Sigma-Aldrich
FLJ39458
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024634, RRID:AB_1856549
Product name
Anti-SAMD12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024634
Antibody type
Polyclonal
Antigen
Sterile alpha motif domain-containing protein 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKN
KNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVA
LWTQQDVCKWLKKHCPNQYQIYSESF
Storage
-20C
Provider Type Product Number
- No reagents -