Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [14]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91116 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91116, RRID:AB_2665806
- Product name
- Anti-NET
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNG
SVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIH
DI- Epitope
- Binds to an epitope located within the peptide sequence HTKYSKYKFTPAAEF as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3063
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat locus coeruleus shows strong immunoreactivity in noradrenaline neurons and fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebral cortex shows positivity in noradrenergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong immunoreactivity in sympathetic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows positivity in noradrenergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse hippocampal formation shows immunoreactivity in noradrenergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human locus coeruleus shows strong cytoplasmic positivity in monoaminergic neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows absence of immunoreactivity (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat pons shows strong positivity in noradrenalne neurons in the locus coeruleus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat cerebellum shows strong positivity in noradrenergic fibers.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows strong positivity in noradrenergic fibers in the cerebral cortex.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse brain shows strong positivity in noradrenergic fibers in the hippocampus.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human locus coeruleus shows strong cytoplasmic positivity in noradrenaline neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong positivity in sympathetic peripheral nerves.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.