Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004057 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SLC6A2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNG
SVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIH
DI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Glycerol-3-Phosphate Acyltransferase-2 Is Expressed in Spermatic Germ Cells and Incorporates Arachidonic Acid into Triacylglycerols
Dorsal root ganglion neurons innervating pelvic organs in the mouse express tyrosine hydroxylase
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Tyagi A, Cattaneo E, Pellon-Maison M, Rabassa M, Lacunza E, Coleman R, Gonzalez-Baro M
PLoS ONE 2012;7(8):e42986
PLoS ONE 2012;7(8):e42986
Dorsal root ganglion neurons innervating pelvic organs in the mouse express tyrosine hydroxylase
Brumovsky P, La J, McCarthy C, Hökfelt T, Gebhart G
Neuroscience 2012;223
Neuroscience 2012;223
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & Cellular Proteomics 2009;8(7):1612-1622
Molecular & Cellular Proteomics 2009;8(7):1612-1622
No comments: Submit comment
No validations: Submit validation data