HPA004057

SLC6A2 antibody from Sigma-Aldrich
NAT1, NET, NET1, SLC6A5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004057
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004057, RRID:AB_1080012
Product name
Anti-SLC6A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004057
Antibody type
Polyclonal
Antigen
Sodium-dependent norepinephrine transporter recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNG
SVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIH
DI
Storage
-20C
Provider Type Product Number
- No reagents -