Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004057 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-SLC6A2 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Sodium-dependent norepinephrine transporter recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNG
SVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIH
DI- Storage
- -20C
Submitted references Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
No validations: Submit validation data