HPA027013

TNFRSF11B antibody from Sigma-Aldrich
OCIF, OPG, TR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027013
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027013, RRID:AB_1854831
Product name
Anti-TNFRSF11B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027013
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 11B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGF
FSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNI
CSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNW
LSVLVDNLPGTKVNAESVERIKRQHS
Storage
-20C
Provider Type Product Number
- No reagents -