HPA012499

MAG antibody from Sigma-Aldrich
GMA, S-MAG, SIGLEC-4A, SIGLEC4A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012499, RRID:AB_1854238
Product name
Anti-MAG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012499
Antibody type
Polyclonal
Antigen
Myelin-associated glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DPILTIFKEKQILSTVIYESELQLELPAVSPEDDG
EYWCVAENQYGQRATAFNLSVEFAPVLLLESHCAA
ARDTVQCLCVVKSNPEPSVAFELPSRNVTVNE
Storage
-20C
Provider Type Product Number
- No reagents -