Antibody data

Product number
H00010584-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010584-M02, RRID:AB_1137145
Product name
COLEC10 monoclonal antibody (M02), clone 1D11
Provider product page
Abnova Corporation - H00010584-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant COLEC10.
Antigen sequence
CGRYRKFVGQLDISIARLKTSMKFVKNVIAGIRET
EEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEA
ANTLIADYVAKSGFFRVFIGVNDLEREGQYMFTDN
TPLQ
Isotype
IgG
Antibody clone number
1D11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -