HPA024511

COLEC10 antibody from Sigma-Aldrich
CL-L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024511
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024511, RRID:AB_1847084
Product name
Anti-COLEC10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024511
Antibody type
Polyclonal
Antigen
Collectin-10 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDEAANTLIADYVAKSGFFRVFIGVNDLEREGQYM
FTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGR
WNDTECHLTMYFVCEFIKKK
Storage
-20C
Provider Type Product Number
- No reagents -