HPA022957

B9D1 antibody from Atlas Antibodies
B9, EPPB9, MKS9, MKSR-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022957
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022957, RRID:AB_1848220
Product name
Anti-B9D1
Provider product page
Atlas Antibodies - HPA022957
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQ
DWAPTAGLEEGISQITSKSQDVRQALVWN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -