HPA022957

B9D1 antibody from Sigma-Aldrich
B9, EPPB9, MKS9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022957
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022957, RRID:AB_1848220
Product name
Anti-B9D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022957
Antibody type
Polyclonal
Antigen
B9 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQ
DWAPTAGLEEGISQITSKSQDVRQALVWN
Storage
-20C
Provider Type Product Number
- No reagents -