Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024036 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024036, RRID:AB_1854147
- Product name
- Anti-MST1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCA
DDQPP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genome-wide association analysis in primary sclerosing cholangitis identifies two non-HLA susceptibility loci
Espen Melum, Andre Franke, Christoph Schramm, Tobias J Weismüller, Daniel Nils Gotthardt, Felix A Offner, Brian D Juran, Jon K Laerdahl, Verena Labi, Einar Björnsson, Rinse K Weersma, Liesbet Henckaerts, Andreas Teufel, Christian Rust, Eva Ellinghaus, Tobias Balschun, Kirsten Muri Boberg, David Ellinghaus, Annika Bergquist, Peter Sauer, Euijung Ryu, Johannes Roksund Hov, Jochen Wedemeyer, Björn Lindkvist, Michael Wittig, Robert J Porte, Kristian Holm, Christian Gieger, H-Erich Wichmann, Pieter Stokkers, Cyriel Y Ponsioen, Heiko Runz, Adolf Stiehl, Cisca Wijmenga, Martina Sterneck, Severine Vermeire, Ulrich Beuers, Andreas Villunger, Erik Schrumpf, Konstantinos N Lazaridis, Michael P Manns, Stefan Schreiber, Tom H Karlsen
Nature Genetics 2010 Dec;43(1):17-19
Nature Genetics 2010 Dec;43(1):17-19
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes and plasma.
- Sample type
- HUMAN