HPA024036

MST1 antibody from Atlas Antibodies
D3F15S2, DNF15S2, HGFL, MSP, NF15S2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024036
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024036, RRID:AB_1854147
Product name
Anti-MST1
Provider product page
Atlas Antibodies - HPA024036
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCA
DDQPP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -