HPA024036

MST1 antibody from Sigma-Aldrich
D3F15S2, DNF15S2, HGFL, MSP, NF15S2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024036
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024036, RRID:AB_1854147
Product name
Anti-MST1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024036
Antibody type
Polyclonal
Antigen
Hepatocyte growth factor-like protein Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCA
DDQPP
Storage
-20C
Provider Type Product Number
- No reagents -