HPA004186

GIT1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004186
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004186, RRID:AB_1078967
Product name
Anti-GIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004186
Antibody type
Polyclonal
Antigen
ARF GTPase-activating protein GIT1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARS
MDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMK
VSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSA
L
Storage
-20C
Provider Type Product Number
- No reagents -