HPA019684

CCN3 antibody from Atlas Antibodies
IGFBP9, NOV
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019684
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019684, RRID:AB_1846190
Product name
Anti-NOV
Provider product page
Atlas Antibodies - HPA019684
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPS
NQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQC
TCRDGQIGC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -