HPA019684

NOV antibody from Sigma-Aldrich
CCN3, IGFBP9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019684
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019684, RRID:AB_1846190
Product name
Anti-NOV antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019684
Antibody type
Polyclonal
Antigen
Protein NOV homolog Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPS
NQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQC
TCRDGQIGC
Storage
-20C
Provider Type Product Number
- No reagents -