HPA023700

ENPP2 antibody from Sigma-Aldrich
ATX, PD-IALPHA, PDNP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023700, RRID:AB_1848170
Product name
Anti-ENPP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023700
Antibody type
Polyclonal
Antigen
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRC
DNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEV
RNEENA
Storage
-20C
Provider Type Product Number
- No reagents -