HPA004061

C17orf75 antibody from Atlas Antibodies
NJMU-R1, SRI2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004061
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004061, RRID:AB_1078337
Product name
Anti-C17orf75
Provider product page
Atlas Antibodies - HPA004061
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAET
PSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGA
VFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPE
TVTI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -