HPA004061

C17orf75 antibody from Sigma-Aldrich
NJMU-R1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004061
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004061, RRID:AB_1078337
Product name
Anti-C17orf75 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004061
Antibody type
Polyclonal
Antigen
Protein Njmu-R1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAET
PSGDDFSLSLADTNLPSEVEPELRSFIAKRLSRGA
VFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPE
TVTI
Storage
-20C
Provider Type Product Number
- No reagents -