HPA024123

ATXN3 antibody from Sigma-Aldrich
ATX3, JOS, MJD, SCA3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024123, RRID:AB_1845133
Product name
Anti-ATXN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024123
Antibody type
Polyclonal
Antigen
ataxin 3 isoform 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSGNMDDSGFFSIQVISNALKVWGLELILFNSPEY
QRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLN
SLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDL
PDCEADQLLQMIRVQQMHRPKLIG
Storage
-20C
Provider Type Product Number
- No reagents -