Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004063 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-AIP
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPME
LIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVV
LYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHS
SLG- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Dietary sodium modulates the interaction between efferent and afferent renal nerve activity by altering activation of α2-adrenoceptors on renal sensory nerves
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Renal sympathetic nerve activity modulates afferent renal nerve activity by PGE2-dependent activation of α1- and α2-adrenoceptors on renal sensory nerve fibers
Kato B, Nicholson G, Neiman M, Rantalainen M, Holmes C, Barrett A, Uhlén M, Nilsson P, Spector T, Schwenk J
Proteome Science 2011;9(1):73
Proteome Science 2011;9(1):73
Dietary sodium modulates the interaction between efferent and afferent renal nerve activity by altering activation of α2-adrenoceptors on renal sensory nerves
Kopp U, Cicha M, Smith L, Ruohonen S, Scheinin M, Fritz N, Hökfelt T
American Journal of Physiology-Regulatory, Integrative and Comparative Physiology 2011;300(2):R298-R310
American Journal of Physiology-Regulatory, Integrative and Comparative Physiology 2011;300(2):R298-R310
Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & Cellular Proteomics 2009;8(7):1612-1622
Molecular & Cellular Proteomics 2009;8(7):1612-1622
Renal sympathetic nerve activity modulates afferent renal nerve activity by PGE2-dependent activation of α1- and α2-adrenoceptors on renal sensory nerve fibers
Kopp U, Cicha M, Smith L, Mulder J, Hökfelt T
American Journal of Physiology-Regulatory, Integrative and Comparative Physiology 2007;293(4):R1561-R1572
American Journal of Physiology-Regulatory, Integrative and Comparative Physiology 2007;293(4):R1561-R1572
No comments: Submit comment
No validations: Submit validation data