HPA004063

AIP antibody from Sigma-Aldrich
ARA9, FKBP16, XAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004063
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004063, RRID:AB_1078115
Product name
Anti-AIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004063
Antibody type
Polyclonal
Antigen
AH receptor-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPME
LIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVV
LYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHS
SLG
Storage
-20C
Provider Type Product Number
- No reagents -