HPA015746

SRM antibody from Sigma-Aldrich
SPS1, SRML1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015746
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015746, RRID:AB_1857472
Product name
Anti-SRM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015746
Antibody type
Polyclonal
Antigen
Spermidine synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKE
MRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKN
PSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFV
LPEF
Storage
-20C
Provider Type Product Number
- No reagents -