HPA012500

GPLD1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012500
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012500, RRID:AB_1849931
Product name
Anti-GPLD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012500
Antibody type
Polyclonal
Antigen
Phosphatidylinositol-glycan-specific phospholipase D precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQ
QNHTQGSKMQKNDFHRNLTTSLTESVDRNINYTER
GVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQL
SQKHVSS
Storage
-20C
Provider Type Product Number
- No reagents -