H00005394-M08

EXOSC10 antibody from Abnova Corporation
p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p

Antibody data

Product number
H00005394-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005394-M08, RRID:AB_1137195
Product name
EXOSC10 monoclonal antibody (M08), clone 1E6
Provider product page
Abnova Corporation - H00005394-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EXOSC10.
Antigen sequence
MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSF
VKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQ
AFCETQGDRLLQCMSRVMQYHGCRSNIKD
Isotype
IgG
Antibody clone number
1E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -