NBP1-57051

FAM118A antibody from Novus Biologicals
bK268H5.C22.4, C22orf8, FLJ20635

Antibody data

Product number
NBP1-57051
Provider
Novus Biologicals
Proper citation
Novus Cat#NBP1-57051, RRID:AB_11015077
Product name
Rabbit Polyclonal FAM118A Antibody
Provider product page
Novus Biologicals - NBP1-57051
Antibody type
Polyclonal
Antigen
Synthetic peptides corresponding to FAM118A (family with sequence similarity 118, member A) The peptide sequence was selected from the middle region of FAM118A. Peptide sequence EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL.
Reactivity
Human
Host
Rabbit
Vial size (┬Ál)
0.05 mg
Concentration (mg/ml)
LYOPH
Storage
Store at -20C. Avoid freeze-thaw cycles.
Provider Type Product Number
- No reagents -