HPA003902

FAM118A antibody from Sigma-Aldrich
bK268H5.C22.4, C22orf8, FLJ20635
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003902
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003902, RRID:AB_1848368
Product name
Anti-FAM118A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003902
Antibody type
Polyclonal
Antigen
Protein FAM118A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQ
ALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADML
LHGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDA
DRVDSTTLLGNACQDCAKRKLEENGIE
Storage
-20C
Provider Type Product Number
- No reagents -