HPA021987

antibody from Atlas Antibodies

Targeting: SLC47A1 FLJ10847, MATE1

Antibody data

Submit

Validation data

Product number: HPA021987 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021987, RRID:AB_1857185
Product name: Anti-SLC47A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILT NDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC47A1 protein structure - HPA021987 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and pancreas tissues using HPA021987 antibody. Corresponding SLC47A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.
Sample type: HUMAN