HPA021987

SLC47A1 antibody from Sigma-Aldrich
FLJ10847, MATE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021987
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021987, RRID:AB_1857185
Product name
Anti-SLC47A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021987
Antibody type
Polyclonal
Antigen
Multidrug and toxin extrusion protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILT
NDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQ
Storage
-20C
Provider Type Product Number
- No reagents -