HPA023806

ZNF48 antibody from Sigma-Aldrich
DKFZp762K013, FLJ31751, MGC43952, ZNF553
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023806
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023806, RRID:AB_1859335
Product name
Anti-ZNF48 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023806
Antibody type
Polyclonal
Antigen
Zinc finger protein 48 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLGSENVISQPNEFEHTPQEDDLGFKEEDLAPDHE
VGNVSLKPEGIQNWDDLWVQREGLGKPQPRDRGPR
LLGEPRWGQASSDRA
Storage
-20C
Provider Type Product Number
- No reagents -