Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004435-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004435-M01, RRID:AB_606069
- Product name
- CITED1 monoclonal antibody (M01), clone 6G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CITED1.
- Antigen sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGA
QAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVV
ELGLDRANELPELWLGQNEFDFTADFPSSC- Isotype
- IgG
- Antibody clone number
- 6G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M01), clone 6G8.Lane 1: CITED1 transfected lysate(19.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CITED1 monoclonal antibody (M01), clone 6G8. Western Blot analysis of CITED1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CITED1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol