Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002893 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-MIPOL1 antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Mirror-image polydactyly gene 1 protein recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAI
ARAKHMEMSLKVLENINPEENDMTLQELLNRINNA
DTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSAL
IEERDAALSKCKRLEQELHHVKEQNQTSANNMRHL
TAENNQ- Storage
- -20C
Submitted references Chromosome 14 transfer and functional studies identify a candidate tumor suppressor gene, mirror image polydactyly 1, in nasopharyngeal carcinoma.
Cheung AK, Lung HL, Ko JM, Cheng Y, Stanbridge EJ, Zabarovsky ER, Nicholls JM, Chua D, Tsao SW, Guan XY, Lung ML
Proceedings of the National Academy of Sciences of the United States of America 2009 Aug 25;106(34):14478-83
Proceedings of the National Academy of Sciences of the United States of America 2009 Aug 25;106(34):14478-83
No comments: Submit comment
No validations: Submit validation data