HPA002893

MIPOL1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002893
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002893, RRID:AB_1079386
Product name
Anti-MIPOL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002893
Antibody type
Polyclonal
Antigen
Mirror-image polydactyly gene 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAI
ARAKHMEMSLKVLENINPEENDMTLQELLNRINNA
DTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSAL
IEERDAALSKCKRLEQELHHVKEQNQTSANNMRHL
TAENNQ
Storage
-20C
Provider Type Product Number
- No reagents -