HPA005709

SNX4 antibody from Atlas Antibodies
ATG24B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005709
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005709, RRID:AB_1080049
Product name
Anti-SNX4
Provider product page
Atlas Antibodies - HPA005709
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEM
GDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEY
LFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQC
EELVTGTVRTFSLKGMTTKLFGQETPEQREARIKV
LEEQINEGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -