HPA005709

SNX4 antibody from Sigma-Aldrich
ATG24B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005709
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005709, RRID:AB_1080049
Product name
Anti-SNX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005709
Antibody type
Polyclonal
Antigen
Sorting nexin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRVRARVADRLYGVYKVHGNYGRVFSEWSAIEKEM
GDGLQSAGHHMDVYASSIDDILEDEEHYADQLKEY
LFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQC
EELVTGTVRTFSLKGMTTKLFGQETPEQREARIKV
LEEQINEGE
Storage
-20C
Provider Type Product Number
- No reagents -