H00010755-B01P

GIPC1 antibody from Abnova Corporation
C19orf3, GIPC, GLUT1CBP, Hs.6454, NIP, RGS19IP1, SEMCAP, SYNECTIN, TIP-2

Antibody data

Product number
H00010755-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010755-B01P, RRID:AB_1573727
Product name
GIPC1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010755-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GIPC1 protein.
Antigen sequence
MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPL
GGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT
GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTH
KVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE
DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVG
DMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK
LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRL
RSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD
TELAATMVELGKDKRNPDELAEALDERLGDFAFPD
EFVFDVWGAIGDAKVGRY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -