HPA023938

DEPTOR antibody from MilliporeSigma / Merck KGaA
DEP.6, DEPDC6, FLJ12428
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023938
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023938, RRID:AB_1847606
Product name
Anti-DEPDC6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023938
Antibody type
Polyclonal
Antigen
DEP domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKE
LIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCD
EH
Storage
-20C
Provider Type Product Number
- No reagents -