HPA024011

DEPTOR antibody from Sigma-Aldrich
DEP.6, DEPDC6, FLJ12428
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024011, RRID:AB_1847608
Product name
Anti-DEPDC6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024011
Antibody type
Polyclonal
Antigen
DEP domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDS
PFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRS
SMSSCGSSGYFSSSPTLSSSPPVLCNPKSV
Storage
-20C
Provider Type Product Number
- No reagents -