SAB1401181

HLA-DRB5 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
SAB1401181
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401181, RRID:AB_10610877
Product name
Anti-HLA-DRB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401181
Antibody type
Polyclonal
Antigen
HLA-DRB5 (NP_002116.2, 1 a.a. ~ 266 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPR
FLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFD
SDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVD
TYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQH
HNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTG
LIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT
SPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAG
LFIYFKNQKG
Storage
-20C
Provider Type Product Number
- No reagents -