Antibody data

Product number
ABIN501989
Provider
antibodies-online
Product name
anti-High Density Lipoprotein Binding Protein (HDLBP) (Middle Region) antibody
Provider product page
antibodies-online - ABIN501989
Antibody type
Polyclonal
Antigen
The immunogen for anti-HDLBP antibody: synthetic peptide directed towards the middle region of human HDLBP
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAA
RDAIL RIVGELEQMV
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -