HPA004189

HDLBP antibody from Sigma-Aldrich
HBP, VGL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004189
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004189, RRID:AB_1079044
Product name
Anti-HDLBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004189
Antibody type
Polyclonal
Antigen
Vigilin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGL
SIMVSGKLDAVMKARKDIVARLQTQASATVAIPKE
HHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQ
IKITGTKEGIEKARHEVLLISAEQDKRAVE
Storage
-20C
Provider Type Product Number
- No reagents -