Antibody data

Product number
H00007373-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007373-M03, RRID:AB_1237678
Product name
COL14A1 monoclonal antibody (M03), clone 1C8
Provider product page
Abnova Corporation - H00007373-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COL14A1.
Antigen sequence
MDPGALEMKNFNKIISFLYSTVGALNKIGTDGTQV
AMVQFTDDPRTEFKLNAYKTKETLLDAIKHISYKG
GNTKTGKAIKYVRDTLFTAESGTRRGIPKVIVVIT
DGRSQDDVNKISREMQLDGYSIFAIGVADADYSEL
VSIGSKPSARHVFFVDDFDAFKKIEDELITFVCET
ASATCPVVHKDGIDLAGFKMMEMFGLVEKDFSSVE
GVSMEPGTFNVFPCYQLHKDALVSQPTRYLHPEGL
PSDYTISFLFRILPDTPQEPFALWEILNKNSDPLV
GVILDNGGKTLTYFNYDQSGDFQTLTFEGPEIRKI
FYGSFHKLHIVVSETLVKVVIDCKQVGEKAMNASA
NITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVC
STSWANTDKCCELPGLRDDESCPDLPHSCSCSETN
EVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRG
EIGLPGPQGPPGPQGPSGLSIQGMPGMPGEKGEKG
DTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDGSS
GPPGPPGPIGIPGTPGVPGITGSMGPQGALGPPGV
PGAKGERGERGDLQSQAMVRSVARQVCEQLTQSHM
ARYTAILNQIPSHSSSIRTVQGPPGEPGRPGSPGA
PGEQGPPGTPGFPGNAGVPGTPGERGLTGIKGEKG
NPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGP
RGPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVRAP
HPDQPEFTPVQDELEAMELWGPGV
Isotype
IgG
Antibody clone number
1C8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -