HPA021787

CENPP antibody from MilliporeSigma / Merck KGaA
CENP-P, RP11-19J3.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021787
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021787, RRID:AB_1846524
Product name
Anti-CENPP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021787
Antibody type
Polyclonal
Antigen
Centromere protein P recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRV
QKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFL
STLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRH
RL
Storage
-20C
Provider Type Product Number
- No reagents -