Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055905-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055905-M01, RRID:AB_426026
- Product name
- ZNF313 monoclonal antibody (M01), clone 4G3-1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ZNF313.
- Antigen sequence
MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEV
YEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA
LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRS
HVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT
FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPI
CASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD
VDEEDMMNQVLQRSIIDQ- Isotype
- IgG
- Antibody clone number
- 4G3-1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional analysis of the RNF114 psoriasis susceptibility gene implicates innate immune responses to double-stranded RNA in disease pathogenesis.
Bijlmakers MJ, Kanneganti SK, Barker JN, Trembath RC, Capon F
Human molecular genetics 2011 Aug 15;20(16):3129-37
Human molecular genetics 2011 Aug 15;20(16):3129-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ZNF313 monoclonal antibody (M01), clone 4G3-1A10 Western Blot analysis of ZNF313 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZNF313 expression in transfected 293T cell line by ZNF313 monoclonal antibody (M01), clone 4G3-1A10.Lane 1: ZNF313 transfected lysate(25.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZNF313 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ZNF313 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol