HPA018872

FRMPD2 antibody from MilliporeSigma / Merck KGaA
MGC35285, PDZD5C, PDZK5C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018872
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018872, RRID:AB_1849151
Product name
Anti-FRMPD2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018872
Antibody type
Polyclonal
Antigen
FERM and PDZ domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISLEGFTFNMAVRMIQNSPDNIELIISQSKGVGGN
NPDEEKNGTANSGVSSTDILSFGYQGSLLSHTQDQ
DRNTEELDMAEVQSLVPRLRHQLSFLPLKGAGSSC
PPSPPEISAGEIYFVE
Storage
-20C
Provider Type Product Number
- No reagents -