HPA004727

HMGCL antibody from Sigma-Aldrich
HL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004727
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004727, RRID:AB_1079074
Product name
Anti-HMGCL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004727
Antibody type
Polyclonal
Antigen
Hydroxymethylglutaryl-CoA lyase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFV
SPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKG
FEAAVAAGAKEVVIFGAASELFTKKNINCSIEESF
QRFDAILKAAQSANISVRGYVSCALGCPYEGKISP
AK
Storage
-20C
Provider Type Product Number
- No reagents -