Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009985 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009985, RRID:AB_1079610
- Product name
- Anti-PIK3CA
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFP
DMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNE
LRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHY
CVTIPEILPKLLLSVK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Clinicopathological Significance of Elevated PIK3CA Expression in Gastric Cancer
Deregulation ofARID1A,CDH1,cMETandPIK3CAand target-related microRNA expression in gastric cancer
Difference in expression of EGFR, pAkt, and PTEN between oropharyngeal and oral cavity squamous cell carcinoma
Progressive 3q Amplification Consistently Targets SOX2 in Preinvasive Squamous Lung Cancer
Jang S, Kim K, Oh M, Lee J, Lee H, Cho H, Han S, Son M, Lee M
Journal of Gastric Cancer 2016;16(2):85
Journal of Gastric Cancer 2016;16(2):85
Deregulation ofARID1A,CDH1,cMETandPIK3CAand target-related microRNA expression in gastric cancer
Ibarrola-Villava M, Llorca-Cardeñosa M, Tarazona N, Mongort C, Fleitas T, Perez-Fidalgo J, Roselló S, Navarro S, Ribas G, Cervantes A
Oncotarget 2015;6(29):26935-26945
Oncotarget 2015;6(29):26935-26945
Difference in expression of EGFR, pAkt, and PTEN between oropharyngeal and oral cavity squamous cell carcinoma
Won H, Jung C, Chun S, Kang J, Kim Y, Sun D, Kim M
Oral Oncology 2012;48(10):985-990
Oral Oncology 2012;48(10):985-990
Progressive 3q Amplification Consistently Targets SOX2 in Preinvasive Squamous Lung Cancer
McCaughan F, Pole J, Bankier A, Konfortov B, Carroll B, Falzon M, Rabbitts T, George P, Dear P, Rabbitts P
American Journal of Respiratory and Critical Care Medicine 2010;182(1):83-91
American Journal of Respiratory and Critical Care Medicine 2010;182(1):83-91
No comments: Submit comment
No validations: Submit validation data