HPA009985

PIK3CA antibody from Sigma-Aldrich
PI3K
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009985
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009985, RRID:AB_1079610
Product name
Anti-PIK3CA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009985
Antibody type
Polyclonal
Antigen
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha-isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFP
DMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNE
LRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHY
CVTIPEILPKLLLSVK
Storage
-20C
Provider Type Product Number
- No reagents -