HPA021479

HSD17B4 antibody from Atlas Antibodies
DBP, MFE-2, SDR8C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021479
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021479, RRID:AB_1844352
Product name
Anti-HSD17B4
Provider product page
Atlas Antibodies - HPA021479
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVT
RAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSA
AKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMT
QTVMPEDLVEALKPEYVAPLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -