HPA021479

HSD17B4 antibody from Sigma-Aldrich
DBP, MFE-2, SDR8C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021479
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021479, RRID:AB_1844352
Product name
Anti-HSD17B4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021479
Antibody type
Polyclonal
Antigen
Peroxisomal multifunctional enzyme type 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVT
RAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSA
AKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMT
QTVMPEDLVEALKPEYVAPLV
Storage
-20C
Provider Type Product Number
- No reagents -