HPA021404

VSTM2A antibody from Sigma-Aldrich
MGC33530, VSTM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021404
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021404, RRID:AB_1853885
Product name
Anti-VSTM2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021404
Antibody type
Polyclonal
Antigen
V-set and transmembrane domain-containing protein 2A Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQ
SGMETHFEPFILPLTNAPQKGQSYRVDRFMNG
Storage
-20C
Provider Type Product Number
- No reagents -